- Home
- Ridiculousness
- Ridiculousness Season 11 Episode 35







Ridiculousness Season 11 Episode 35
Comedian Gary Owen joins Rob, Chanel and Steelo to try out some “Sackupuncture,” watch couples get lost in a “Love Bubble,” and experience redheads reaching their boiling point in a “Ginger Snap.”
Views: 32
Serie: Ridiculousness
Director: Jeff Tremaine, Rob Dyrdek, Shane Nickerson
Guest Star: Chanel West Coast, Chelsea Chanel Dudley, Rob Dyrdek, Sterling Brim
Dead Like Me
Dead Like Me follows a group of undead grim reapers tasked with shepherding the recently departed into the afterlife.
Top Coppers
Badehotellet
BadehotelletisthestoryabouttheguestsandstaffatabeachhotelbytheNorthSeasanddunes.Attheheartofthestoryisthelivesofthreeyoungpeople,thechambermaidFie,themerchant’sdaughterAmanda,andthelocalfishermanMorten.Theirfatesareintertwined,andtheirstoriesareaboutemancipatingthemselvesfromtheplansotherpeoplehavemadeontheirbehalf,theattemptsonsocialascent,andaboutlosingandfindingoneselfontheway.Theseriesisinspiredbythewayoflifeatthemanyseasidehotelsofthepast,andreflectsourowntimewithitsmixtureoffinancialcrisis,denial,anddreamsofhappiness.Thestorytakesplaceintheyears1928-33wheretheworldisfallingapart.Thecharacterswillgothroughtearsandlaughterinthecaptivatingjourneythattakesplaceastimeschangefromoptimismtocrisis.It’samulti-plot-seriesthatdynamicallyshiftsbetweenupstairsanddownstairs,andbetweenseriousnessandhumour.WrittenbyBadehotellet
OutDaughtered
40 bottles a day, 420 diapers a week and feedings every three hours became the new normal for Danielle and Adam Busby when they welcomed home the only all-female set…
Walliams & Friend
Heard It Through the Grapevine
Han In Sang and Seo Bom are young and in love, despite major differences in wealth and status. But all of that hangs in the balance when Han In Sang…
The Dukes of Hazzard
Cousins Bo and Luke Duke and their car “General Lee”, assisted by Cousin Daisy and Uncle Jesse, have a running battle with the authorities of Hazzard County (Boss Hogg and…
666 Park Avenue
What would you do to have everything you desire? Step inside 666 Park Avenue, New York’s most seductive address. We all have some burning needs, desires and ambitions. For the…
Cinema Toast
This anthology series is a post-modernist reinvention of older movies that turns pre-existing imagery from the public domain on its head to tell brand new unique stories spanning genres including…