Not Available

Not Available

Dead Like Me follows a group of undead grim reapers tasked with shepherding the recently departed into the afterlife.

Top Coppers follows the adventures of cops John Mahogany and Mitch Rust, as they attempt to rid the fictional world of Justice City from its deranged criminal underworld. The universe…

BadehotelletisthestoryabouttheguestsandstaffatabeachhotelbytheNorthSeasanddunes.Attheheartofthestoryisthelivesofthreeyoungpeople,thechambermaidFie,themerchant’sdaughterAmanda,andthelocalfishermanMorten.Theirfatesareintertwined,andtheirstoriesareaboutemancipatingthemselvesfromtheplansotherpeoplehavemadeontheirbehalf,theattemptsonsocialascent,andaboutlosingandfindingoneselfontheway.Theseriesisinspiredbythewayoflifeatthemanyseasidehotelsofthepast,andreflectsourowntimewithitsmixtureoffinancialcrisis,denial,anddreamsofhappiness.Thestorytakesplaceintheyears1928-33wheretheworldisfallingapart.Thecharacterswillgothroughtearsandlaughterinthecaptivatingjourneythattakesplaceastimeschangefromoptimismtocrisis.It’samulti-plot-seriesthatdynamicallyshiftsbetweenupstairsanddownstairs,andbetweenseriousnessandhumour.WrittenbyBadehotellet

40 bottles a day, 420 diapers a week and feedings every three hours became the new normal for Danielle and Adam Busby when they welcomed home the only all-female set…

A diverse band of Nazi Hunters living in 1977 New York City discover that hundreds of high ranking Nazi officials are living among us and conspiring to create a Fourth…

Comedy series in which David Walliams is joined by a different guest in each episode for a variety of sketches, alongside a talented supporting cast.

Han In Sang and Seo Bom are young and in love, despite major differences in wealth and status. But all of that hangs in the balance when Han In Sang…

Cousins Bo and Luke Duke and their car “General Lee”, assisted by Cousin Daisy and Uncle Jesse, have a running battle with the authorities of Hazzard County (Boss Hogg and…

What would you do to have everything you desire? Step inside 666 Park Avenue, New York’s most seductive address. We all have some burning needs, desires and ambitions. For the…

This anthology series is a post-modernist reinvention of older movies that turns pre-existing imagery from the public domain on its head to tell brand new unique stories spanning genres including…