






Top Crack Season 2 Episode 4
N/A
Views: 6
Serie: Top Crack
Director: Mario Russo
Guest Star: Anny Degli Uberti, Antonio Altoviti, Consuelo Aranyi, Didier Haudepin, Gastone Moschin, Liana Ferrakian, Lorna Palombini, Mirella Maravidi, Oreste Lionello, Stella Interlenghi, Terry-Thomas
Year: 1966
Residue
Thegovernmentcover-upofthecausesbehindamassiveexplosioninafuturisticUKmetropolisspurphotojournalistJenniferPrestonontosearchforthetruthandintheprocessblowopenaparanormalphenomenonhauntingthecity.
Nature’s Strangest Mysteries: Solved
A team of experts, including biologist Dan Riskin, zoologist Lucy Cooke, wildlife expert Bradley Trevor Greive and marine biologist Andrew Nosal, unpack nature’s strangest mysteries to reveal the explanations behind…
Tales from the Crypt
Tales from the Crypt, sometimes titled HBO’s Tales from the Crypt, is an American horror anthology television series that ran from June 10, 1989 to July 19, 1996 on the…
Hollington Drive
A four-part thriller that focuses on the lives of sisters Theresa and Helen after a kid in their neighbourhood goes missing.
Fish or Die
Fourdiehardfishermenaredeterminedtobethefirsttofishthemostremotewatersleftonearth.Alongtheway,theywillbattletheelements,dodgedrugcartelsandendurehell,astheyrisktheirlivesinanattempttolivetheirdream.
Small Time Gangster
Small Time Gangster is an Australian drama series produced by Boilermaker-Burberry Entertainment for Movie Extra subscription television channel. The series follows the adventures of Tony Piccolo, a man who works…
The Watcher
Ominous letters. Strange neighbors. Sinister threats. A family moves into their suburban dream home, only to discover they’ve inherited a nightmare.
The X Factor New Zealand
ContestantsbattleitouttobecrownedthewinnerofXfactorNewZealand.
History of Swear Words
This proudly profane series explores the history and impact of some of the most notorious bad words in the English language.