- Home
- Deliciousness
- Deliciousness Season 3 Episode 9







Deliciousness Season 3 Episode 9
Hoarding favorite foods in “Super Stocked”; ignoring expiration dates in “Old Gold”; getting protein in “Meat Lovers.”
Serie: Deliciousness
Guest Star: Angela Kinsey, Kel Mitchell, Tiffani Thiessen, Tim Chantarangsu
Carters Get Rich
The Widow
A woman’s search to uncover the mystery of the disappearance of her husband leads her to the Congo, where she’s forced to seek the truth about what happened to the…
Billion Dollar Wreck
MartinBayerle,whofirstlocatedthesunkenRMSRepublicin270feetofwatersouthoftheislandNantucketin1981,makeshissecondmajorrecoverymissiontothewreck.Thevessel,builtin1903andsunkwhenshewasinadvertentlyrimmedbroadsideinpoorvisibilityin1909,isrumoredtohaveonboarduntoldmillionsinface-valuegoldcoins-anamountthatcouldexceed$1Billionintoday’scurrencyvalues.Bayerle,whowasonceimprisonedformanslaughteraftershootingandkillingamanwhowashavinganaffairwithhiswifeandattemptedtoextortmoneyfromBayerletoleave,maypossessbetterinformationastowhereonthewreckagethegoldmayrest;he’sassembledagroupofprovensalvers,includinghisownson,todive,explore,andifpossiblerecovertheentombedriches.Writtenbyjb0579
Street Outlaws: Gone Girl
Street racing is a motorsport with no barriers. If you can drive and you’re fast, then you can take home the win. The fastest female drivers from around the country…
Jo Frost on Britain’s Killer Kids
JoFrost,whohasworkedwithchildrenasanannyfor28years,investigatesthecasesofBritain’skillerkidsinordertoanswerwhetherchildrencanbenaturalbornkillers.
Benjamin Franklin
Explore the revolutionary life of one of the 18th century’s most consequential and compelling personalities, whose work and words unlocked the mystery of electricity and helped create the United States.
Elvis Goes There
Follow renowned journalist Elvis Mitchell as he travels with A-list filmmakers and actors to places of inspiration around the world with unprecedented access, exploring how each location shaped their work…