Ax Men Season 6 Episode 19
In Florida, Brad and Swilley fight against a massive log–and lose. Then, when they get back to the landing, they are greeted by a very unexpected guest. The Swamp Man goes gar fishing with his cousin Cheyenne and they find what could be the log raft! At Rygaard, a tight landing is making everyone nervous. But when a loose log tumbles, Craig’s reaction takes everyone by surprise. And at Lemare, a terrifying road scares everyone away.
Boss Nails
The series follows 26-year-old Dana Cody, the glamorous and sassy owner of Tippie Toes Beauty Lounge in Miami. A no-nonsense boss, Dana is determined to continue the legacy her mother…
Final Moments
Delve into heart-wrenching crimes through the lens of real footage of victim’s last moments alive. Each hourlong episode tracks a different investigation in which law enforcement’s efforts to solve a…
Alaska Haunting
Ready For This
The Bazillion Dollar Club
Whatiftheoddswere2%massivesuccessand98%completefailure?Wouldyoutakethatbet?Setinthebellyofthebeast-SiliconValley,BazillionDollarClub,isahighadrenaline,high-stakesdocu-seriesthatimmersesviewersinthebrilliantandcutthroatworldoftoday’smostinterestingandforwardthinkinginnovators.Theseriesfollowstwooftheworld’smostaggressiveacceleratorprograms:thesoftwareconcentrated,500Startups,ledbytherelentlessdrillsergeantDaveMcClure;andthehardwarefocused,Highway1,headedbyquirkygeniusBradyForrest,astheyguide,challenge,inspireandpushaselectgroupofstartupcompaniesonaquesttogettheirinnovativeideasofftheground.Whoissittingonthenextbigthing?Abillionairemaybeborn-launchedorsenthome!
Big Fix Alaska
BigFixAlaskachroniclesthewildadventuresofafullservicemastermechanicshopthattakesonhigh-riskjobsacrossthefrozenTundra.Riskinglifeandlimboneveryjob,thischarismatic10+manteamofAlaskaroughnecksbravetheelementsandworkaroundtheclockrepairingsupermachinesundertheharshestconditionsandinthemostremoteplacesintheworld.Danger,riskandincredibleskill,aresomeoftheattributesthesepremiermastermechanicsputtothetestrepairinganythingandeverythingwithanengine.Theyarespecialistsofadifferentbreedandcanfixthingsfromastrandedcrabboatsinthemiddleofthebearingseatomulti-million-dollarcranesfrozentotheearthneartheNorthPole.Withaconstantworkschedule,highstakesand24-hourservice,thereisneveradullmoment
The Plague
HowapocalypticpandemicknownasBlackDeathorsimplythePlaguedevastatedEuropebetween1346and1353,leavinghalfofitspopulationdead.Associalandreligiousorderfellapart,superstition,zealotryandmurdertookitsplace.
Dirty Money
From crippling payday loans to cars that cheat emissions tests, this investigative series exposes brazen acts of corporate greed and corruption.
Rostered On
RosteredOnisanindependentAustraliancomedyshowbasedaroundthedaytodaystrugglesofworkingforafacelessretailcorporationElectroworld.
Martial Master
The protagonist Qin Chen, who was originally the top genius in the military domain, was conspired by the people to fall into the death canyon in the forbidden land of…
Badehotellet
BadehotelletisthestoryabouttheguestsandstaffatabeachhotelbytheNorthSeasanddunes.Attheheartofthestoryisthelivesofthreeyoungpeople,thechambermaidFie,themerchant’sdaughterAmanda,andthelocalfishermanMorten.Theirfatesareintertwined,andtheirstoriesareaboutemancipatingthemselvesfromtheplansotherpeoplehavemadeontheirbehalf,theattemptsonsocialascent,andaboutlosingandfindingoneselfontheway.Theseriesisinspiredbythewayoflifeatthemanyseasidehotelsofthepast,andreflectsourowntimewithitsmixtureoffinancialcrisis,denial,anddreamsofhappiness.Thestorytakesplaceintheyears1928-33wheretheworldisfallingapart.Thecharacterswillgothroughtearsandlaughterinthecaptivatingjourneythattakesplaceastimeschangefromoptimismtocrisis.It’samulti-plot-seriesthatdynamicallyshiftsbetweenupstairsanddownstairs,andbetweenseriousnessandhumour.WrittenbyBadehotellet