A pie-maker, with the power to bring dead people back to life, solves murder mysteries with his alive-again childhood sweetheart, a cynical private investigator, and a lovesick waitress.

Behind-the scenes access to the surgeons who fix disastrous surgeries of celebrities.

By day the workplace is rational and efficient, but at night the same offices, hotels and restaurants become the domain of the supernatural and unexplained. Those who work the graveyard…

MartinBayerle,whofirstlocatedthesunkenRMSRepublicin270feetofwatersouthoftheislandNantucketin1981,makeshissecondmajorrecoverymissiontothewreck.Thevessel,builtin1903andsunkwhenshewasinadvertentlyrimmedbroadsideinpoorvisibilityin1909,isrumoredtohaveonboarduntoldmillionsinface-valuegoldcoins-anamountthatcouldexceed$1Billionintoday’scurrencyvalues.Bayerle,whowasonceimprisonedformanslaughteraftershootingandkillingamanwhowashavinganaffairwithhiswifeandattemptedtoextortmoneyfromBayerletoleave,maypossessbetterinformationastowhereonthewreckagethegoldmayrest;he’sassembledagroupofprovensalvers,includinghisownson,todive,explore,andifpossiblerecovertheentombedriches.Writtenbyjb0579

Paul O’Leary, Helen Parker and Robin McLellan of deVOL Kitchens lead their skilled team of artisans to craft beautiful kitchens and furnishings for their clients from their 16th-century water mill-turned-workshop…

LivetoTellisaharrowingandimpactfulportrayalofthetriumphsandsacrificestheUnitedStatesSpecialOperationsForceshaveenduredonthebattlefieldsofAfghanistanandIraq.FromexecutiveproducerPeterBerg(LoneSurvivor),thisisanintimatelookintocontemporaryU.S.SpecialForcesmissions.Drivenbyfirst-personstorytelling,archivalfootageandoriginalcinematicsequences,eachepisodeisavisceralandpersonalperspectiveofthehumanexperienceofwar.WrittenbyHistoryChannel

Not Available

The Teenage Mutant Ninja Turtles are back in an all-new animated series on Nickelodeon! Surfacing topside for the first time on their fifteenth birthday, the titular turtles, Leonardo, Michelangelo, Raphael…

Not Available

Candidatescompetetowinovertheheartsoffoureligiblecelebritybachelor/bachelorettes.SimilartoTheVoice,thereisablindroundfirstwherecontestantstrytowinthemoverwiththeirpersonality.

Follows the professional and personal lives of the cast of MTV’s ‘The Hills’ and their their friends and kids, years after the final episode aired.

In this fresh take on the Arthurian legend, teenager Nimue joins forces with mercenary Arthur on a quest to find Merlin and deliver an ancient sword.