- Home
- Celebrity Big Brother
- Celebrity Big Brother Season 10 Episode 14
First and Last
Aretiredmandecidestofulfillhislife-timeambitionandwalkthelengthofBritainfromLand’sEndtoJohnO’Groats.Thefilmcentresaroundthediscoveryofhimself,therelationshipwithhiswife(whoisunsureofhisreasons)andthecolourful,andnotsocolourful,peoplehemeetsonhistravels.WrittenbyDavidLaoide-Kemp
L.A. Clippers Dance Squad
ThisdocuseriesgoesinsidetheLosAngelesClippers’squadtoprovideviewerswithalookatwhatittakestobeamemberofanelitedanceteambothonandoffthecourt.TheteamisledbynewcreativedirectorPetraPope,whohaspreviouslyworkedforotherNBAteams.OncePopeselectsdancersfortheteam,thepressureisonforthemtoworkhardsotheycansucceedinthebigleaguesastheytrytobalancetheircareerswithfamilylifeamidsttheglitzandglamourofHollywood.Writtenbysofiadagher
The Origins of Coronavirus Explained in 1 Minute
TheCOVID-19virus,oftenreferredtoastheCorona-virus,isbelievedtohaveoriginatedfromaso-calledwetmarketinWuhan,wherewildanimalshavebeenshovedintocrowdedcagesalongsideeachother,readytobekilledandcookedinfrontofcustomers.Insuchplaces,youcaneasilybeexposedtoinfectiousdiseases.Thisvideoalsoprovidesusacloserlookatthefascinatingmammal,thepangolin,thatisunfortunatelythemosttraffickedanimalspeciesintheworld.Writtenbychribren
Bring the Noise
Comedy Night with Rick Mercer
Presented by legendary comedy icon and TV personality, Rick Mercer, featuring an incredible lineup of Canadian comedians, including stand-up performances from Rick Mercer himself. The series will also feature never-before-seen…
Man Vs Bee
A man finds himself at war with a bee while house-sitting a luxurious mansion. Who will win, and what irreparable damage will be done in the process?
Phenoms
Documentary series chronicling the journey of world’s next great soccer players on their quests to represent their respective countries in the 2018 World Cup™.
Doom Patrol
The Doom Patrol’s members each suffered horrible accidents that gave them superhuman abilities — but also left them scarred and disfigured. Traumatized and downtrodden, the team found purpose through The…
Residue
Thegovernmentcover-upofthecausesbehindamassiveexplosioninafuturisticUKmetropolisspurphotojournalistJenniferPrestonontosearchforthetruthandintheprocessblowopenaparanormalphenomenonhauntingthecity.
Big Fix Alaska
BigFixAlaskachroniclesthewildadventuresofafullservicemastermechanicshopthattakesonhigh-riskjobsacrossthefrozenTundra.Riskinglifeandlimboneveryjob,thischarismatic10+manteamofAlaskaroughnecksbravetheelementsandworkaroundtheclockrepairingsupermachinesundertheharshestconditionsandinthemostremoteplacesintheworld.Danger,riskandincredibleskill,aresomeoftheattributesthesepremiermastermechanicsputtothetestrepairinganythingandeverythingwithanengine.Theyarespecialistsofadifferentbreedandcanfixthingsfromastrandedcrabboatsinthemiddleofthebearingseatomulti-million-dollarcranesfrozentotheearthneartheNorthPole.Withaconstantworkschedule,highstakesand24-hourservice,thereisneveradullmoment
Invisible City
An environmental police officer uncovers a hidden world of mythological entities from Brazilian folklore when he finds a connection between the mysterious appearance of a dead river dolphin on a…
The Great Pottery Throw Down
Ten home potters from around the country head to Stoke-on-Trent, the home of pottery, in their quest to become Top Potter.