Hostages is an American drama television series that airs on CBS as part of the 2013–14 American television season. The series is based on a similar Israeli series created by…

By day the workplace is rational and efficient, but at night the same offices, hotels and restaurants become the domain of the supernatural and unexplained. Those who work the graveyard…

ThesurvivalofwildlifeovertwentyfourhoursinAustralia,attheendofthewetseason.IntheairtheSeaEagleisthemasteroftheskies,abletopluckFishfromthewateroraBatfromtheair.InthebillabongtheSaltWaterCrocodile,thelargestreptileonearth,reignssupreme,activelypursuingpreyorlayinginambush.

Behind-the scenes access to the surgeons who fix disastrous surgeries of celebrities.

The history of the Vikings is explored by “Vikings” star Clive Standen, who joins experts in Europe to learn how the Vikings successfully invaded England and France.

The story of Espen, a man in his thirties who is loved by everyone. Every day is a party and there’s no limit to what he experiences. We meet Espen…

The story of Victorian serial killer Mary Ann Cotton, a poisoner whose methods leave no visible scars, allowing her tally of victims to mount, unsuspected by a Victorian society unable…

An edge-of-your-seat view into the lives of everyday heroes committed to one of America’s noblest professions. For the firefighters, rescue squad and paramedics of Chicago Firehouse 51, no occupation is…

In 1950s Spain, a couple summon their son home from Mexico to introduce him to his fiancée, but are shocked when he returns with a ballerino.

TheCOVID-19virus,oftenreferredtoastheCorona-virus,isbelievedtohaveoriginatedfromaso-calledwetmarketinWuhan,wherewildanimalshavebeenshovedintocrowdedcagesalongsideeachother,readytobekilledandcookedinfrontofcustomers.Insuchplaces,youcaneasilybeexposedtoinfectiousdiseases.Thisvideoalsoprovidesusacloserlookatthefascinatingmammal,thepangolin,thatisunfortunatelythemosttraffickedanimalspeciesintheworld.Writtenbychribren

Australian version of the comedy-variety show where children take to the stage to showcase their passion and blow you away with their talent.

Key & Peele is an American sketch comedy television show. It stars Keegan-Michael Key and Jordan Peele, both former cast members of MADtv. Each episode of the show consists of…