- Home
- High Stakes Poker
- High Stakes Poker Season 8 Episode 11
High Stakes Poker Season 8 Episode 11
N/A
Serie: High Stakes Poker
Director: Henry Orenstein
Guest Star: A.J. Benza, Antonio Esfandiari, Barry Greenstein, Corey Zeidman, Daniel Negreanu, Doyle Brunson, Gabe Kaplan, Guy Laliberté, Kara Scott, Phil Ivey, Sam Farha
The Mod Squad
The Mod Squad was the enormously successful groundbreaking “hippie” undercover cop show that ran on ABC from September 24, 1968, until August 23, 1973. It starred Michael Cole as Pete…
My Demon
A pitiless demon becomes powerless after getting entangled with an icy heiress, who may hold the key to his lost abilities — and his heart.
Residue
Thegovernmentcover-upofthecausesbehindamassiveexplosioninafuturisticUKmetropolisspurphotojournalistJenniferPrestonontosearchforthetruthandintheprocessblowopenaparanormalphenomenonhauntingthecity.
Daybreak
Living his best life in post-apocalyptic LA, a slacker strives to find the girl of his dreams while outwitting mindless ghouls and cliquish gangs.
Badehotellet
BadehotelletisthestoryabouttheguestsandstaffatabeachhotelbytheNorthSeasanddunes.Attheheartofthestoryisthelivesofthreeyoungpeople,thechambermaidFie,themerchant’sdaughterAmanda,andthelocalfishermanMorten.Theirfatesareintertwined,andtheirstoriesareaboutemancipatingthemselvesfromtheplansotherpeoplehavemadeontheirbehalf,theattemptsonsocialascent,andaboutlosingandfindingoneselfontheway.Theseriesisinspiredbythewayoflifeatthemanyseasidehotelsofthepast,andreflectsourowntimewithitsmixtureoffinancialcrisis,denial,anddreamsofhappiness.Thestorytakesplaceintheyears1928-33wheretheworldisfallingapart.Thecharacterswillgothroughtearsandlaughterinthecaptivatingjourneythattakesplaceastimeschangefromoptimismtocrisis.It’samulti-plot-seriesthatdynamicallyshiftsbetweenupstairsanddownstairs,andbetweenseriousnessandhumour.WrittenbyBadehotellet
Maradona in Mexico
The Dorados, Culiacan’s local team, are at the bottom of the rankings when Maradona arrives, looking for a fresh start. The experts predict disaster.
Homes by the med
The Island
Resident Evil
Nearly three decades after the discovery of the T-virus, an outbreak reveals the Umbrella Corporation’s dark secrets. Based on the horror franchise.
The Sandman
After years of imprisonment, Morpheus — the King of Dreams — embarks on a journey across worlds to find what was stolen from him and restore his power.