Drivenbyrevenge,human-turned-vampireMiasetsouttovanquishDmitry,aruthlessvampireleaderwhoseeksanartifactthatgrantsimmortality.

Tales from the Darkside is an anthology horror TV series created by George A. Romero; it was released in 1984. Similar to Amazing Stories, The Twilight Zone, Night Gallery, The…

A young couple with a dream seek to build the world’s first legal marijuana empire.

Canada’s Worst Driver is a Canadian television series on Discovery Channel, based on Britain’s Worst Driver, and is part of the Worst Driver television franchise. It and sister series Canada’s…

Stephen Mangan hosts the comedy panel show with Richard Osman, Katherine Ryan, Jon Richardson and Richard Ayoade to peek behind the façade of outlandish headlines and alternative facts!

Inathree-partUKTVOriginal,surrealGeordiestand-upandbikeenthusiastRossNoblereturnstoDavetotakeontheultimatebikingchallenge-thegruellingScottishSixDaysTrial.

Each Challenge pits numerous cast members from past seasons of Real World and Road Rules against each other (only the Fresh Meat Challenge has introduced new cast members that have…

This anthology series is a post-modernist reinvention of older movies that turns pre-existing imagery from the public domain on its head to tell brand new unique stories spanning genres including…

Not Available

Eachweek,ateamoffivechildcookingprodigies,ages9through16,challengesanexecutive-levelchefinthekitchen,inathree-roundcompetition.

MartinBayerle,whofirstlocatedthesunkenRMSRepublicin270feetofwatersouthoftheislandNantucketin1981,makeshissecondmajorrecoverymissiontothewreck.Thevessel,builtin1903andsunkwhenshewasinadvertentlyrimmedbroadsideinpoorvisibilityin1909,isrumoredtohaveonboarduntoldmillionsinface-valuegoldcoins-anamountthatcouldexceed$1Billionintoday’scurrencyvalues.Bayerle,whowasonceimprisonedformanslaughteraftershootingandkillingamanwhowashavinganaffairwithhiswifeandattemptedtoextortmoneyfromBayerletoleave,maypossessbetterinformationastowhereonthewreckagethegoldmayrest;he’sassembledagroupofprovensalvers,includinghisownson,todive,explore,andifpossiblerecovertheentombedriches.Writtenbyjb0579

Not Available