- Home
- Republic of Doyle
- Republic of Doyle Season 4 Episode 13







Republic of Doyle Season 4 Episode 13
With Tinny abducted at gunpoint by Maurice Becker, Jake and Crocker have no choice but to work together to get her back. While being held captive, Tinny attempts to get into Becker’s head.
Views: 8
Serie: Republic of Doyle
Director: Allan Hawco, Malcolm MacRury, Perry Chafe
Guest Star: Allan Hawco, Bob Cole, Krystin Pellerin, Lynda Boyd, Mark O'Brien, Marthe Bernard, Sean McGinley, Sean Panting, Steve O'Connell
Moon Knight
When Steven Grant, a mild-mannered gift-shop employee, becomes plagued with blackouts and memories of another life, he discovers he has dissociative identity disorder and shares a body with mercenary Marc…
Badehotellet
BadehotelletisthestoryabouttheguestsandstaffatabeachhotelbytheNorthSeasanddunes.Attheheartofthestoryisthelivesofthreeyoungpeople,thechambermaidFie,themerchant’sdaughterAmanda,andthelocalfishermanMorten.Theirfatesareintertwined,andtheirstoriesareaboutemancipatingthemselvesfromtheplansotherpeoplehavemadeontheirbehalf,theattemptsonsocialascent,andaboutlosingandfindingoneselfontheway.Theseriesisinspiredbythewayoflifeatthemanyseasidehotelsofthepast,andreflectsourowntimewithitsmixtureoffinancialcrisis,denial,anddreamsofhappiness.Thestorytakesplaceintheyears1928-33wheretheworldisfallingapart.Thecharacterswillgothroughtearsandlaughterinthecaptivatingjourneythattakesplaceastimeschangefromoptimismtocrisis.It’samulti-plot-seriesthatdynamicallyshiftsbetweenupstairsanddownstairs,andbetweenseriousnessandhumour.WrittenbyBadehotellet
Glitch Techs
Game-world monsters are wreaking real-world havoc. Here comes tech support!
The Ministry of Time
A soldier from the 15th century, a university student from the 19th century and a nurse from the present join the secret ‘Department of Time’, a secret department within the…
Wild Bill
Reno Rumble
The Most Dangerous Animal of All
Residue
Thegovernmentcover-upofthecausesbehindamassiveexplosioninafuturisticUKmetropolisspurphotojournalistJenniferPrestonontosearchforthetruthandintheprocessblowopenaparanormalphenomenonhauntingthecity.
Fancy Boy
Big Hero 6 The Series
Picking up immediately following the events in the feature film, these are the continuing adventures and friendship of 14-year-old tech genius Hiro and his compassionate, cutting-edge robot Baymax. As the…
The Devil Next Door
A Cleveland grandfather is brought to trial in Israel, accused of being the infamous Nazi death camp guard known as Ivan the Terrible.