Have Gun – Will Travel
Have Gun – Will Travel is an American Western television series that aired on CBS from 1957 through 1963. It was rated number three or number four in the Nielsen…
Pretty Little Liars: The Perfectionists
In Beacon Heights, a seemingly perfect town, a group of three college friends struggle with the stress of being overachievers. In the aftermath of the town’s first murder, each Perfectionist…
Cleaning Up
The characterful drama focuses on an ordinary working class woman, Sam, who is caught between two worlds – the everyday life of a devoted and loving Mum and the darker,…
Pushing the Line
Friends and rivals try to walk thin, nylon ropes stretched 500 feet in the air. On the line, the daredevils push each other to do something bigger and crazier than…
House of Secrets: The Burari Deaths
Suicide, murder… or something else? This docuseries examines chilling truths and theories around the deaths of 11 members of a Delhi family.
Bon Appetit
Fish or Die
Fourdiehardfishermenaredeterminedtobethefirsttofishthemostremotewatersleftonearth.Alongtheway,theywillbattletheelements,dodgedrugcartelsandendurehell,astheyrisktheirlivesinanattempttolivetheirdream.
Growing Belushi
Actor and comedian Jim Belushi embarks on a new career as a legal cannabis farmer. Viewers get unprecedented access to Belushi’s marijuana farm in southern Oregon, as he builds a…
The Greek Islands with Julia Bradbury
Thetelevisionpresenter,whosemotherisGreek,uncoversthehiddensideofwell-knownGreekIslandsgoingoffthewell-troddentouristtracktoexplore,immerseherselfinlocaltraditionsandsamplethefood.
Martial Master
The protagonist Qin Chen, who was originally the top genius in the military domain, was conspired by the people to fall into the death canyon in the forbidden land of…
Between Him and Her
Hyeon-seongandSeong-ok,meetingaftersevenyears,reflectingontheirloveandfatigue,standingalongsidedifferentpartnersinfrontofamotelelevator.