Whatiftheoddswere2%massivesuccessand98%completefailure?Wouldyoutakethatbet?Setinthebellyofthebeast-SiliconValley,BazillionDollarClub,isahighadrenaline,high-stakesdocu-seriesthatimmersesviewersinthebrilliantandcutthroatworldoftoday’smostinterestingandforwardthinkinginnovators.Theseriesfollowstwooftheworld’smostaggressiveacceleratorprograms:thesoftwareconcentrated,500Startups,ledbytherelentlessdrillsergeantDaveMcClure;andthehardwarefocused,Highway1,headedbyquirkygeniusBradyForrest,astheyguide,challenge,inspireandpushaselectgroupofstartupcompaniesonaquesttogettheirinnovativeideasofftheground.Whoissittingonthenextbigthing?Abillionairemaybeborn-launchedorsenthome!

MartinBayerle,whofirstlocatedthesunkenRMSRepublicin270feetofwatersouthoftheislandNantucketin1981,makeshissecondmajorrecoverymissiontothewreck.Thevessel,builtin1903andsunkwhenshewasinadvertentlyrimmedbroadsideinpoorvisibilityin1909,isrumoredtohaveonboarduntoldmillionsinface-valuegoldcoins-anamountthatcouldexceed$1Billionintoday’scurrencyvalues.Bayerle,whowasonceimprisonedformanslaughteraftershootingandkillingamanwhowashavinganaffairwithhiswifeandattemptedtoextortmoneyfromBayerletoleave,maypossessbetterinformationastowhereonthewreckagethegoldmayrest;he’sassembledagroupofprovensalvers,includinghisownson,todive,explore,andifpossiblerecovertheentombedriches.Writtenbyjb0579

In 1960s Spain, a Holocaust survivor joins a group of agents seeking justice against the hundreds of Nazis who fled to the nation to hide after WWII.

A British woman and her husband seek a fresh start in Australia after infidelity in their marriage. The couple hire a young nanny, but she isn’t the innocent stranger she…

Not Available

Holly’s World, originally titled Planet Holly, is an American reality television series that debuted on E! on December 6, 2009.

Kenny and Spenny are two best friends who compete against each other. Their competitions are ridiculous, immature and totally intense.

In 1979, three young women were killed in a streak of brutal murders in Fall River, MA, allegedly by a satanic cult practicing human sacrifice. Twenty years later, new evidence…

Follow a disillusioned teen recruited into a storied high school for assassins. Maintaining his moral code while surviving a ruthless curriculum, vicious social cliques, and his own adolescent uncertainties may…

A self-proclaimed intellectual, forced to move in with her carefree sister and her sister’s lovably eccentric friends.

By day the workplace is rational and efficient, but at night the same offices, hotels and restaurants become the domain of the supernatural and unexplained. Those who work the graveyard…

Power & Ice introduces viewers to the brave men who maintain and build the remote and rugged Alaskan power grid. The series follows three fiercely competitive line companies as they…