- Home
- Tig n' Seek
- Tig n’ Seek Season 2 Episode 12
Tig n’ Seek Season 2 Episode 12
Tiggy and Prangle Penguin compete for Mrs. Grendelson’s heart.
Serie: Tig n' Seek
Guest Star: Jemaine Clement, Kash Abdulmalik, Myke Chilian, Rich Fulcher, Wanda Sykes
Relentless With Kate Snow
Journalist Kate Snow takes a journey with families as they go to great lengths to find answers about their loved ones’ deaths. These ordinary heroes go undercover, hunt for evidence…
Residue
Thegovernmentcover-upofthecausesbehindamassiveexplosioninafuturisticUKmetropolisspurphotojournalistJenniferPrestonontosearchforthetruthandintheprocessblowopenaparanormalphenomenonhauntingthecity.
Game Face
Former Face Off all-stars go head-to-head each week, with multiple make-up reveals and eliminations throughout each exciting episode. Every week, four artists will race against the clock to complete three…
UFO
A secret, high-technology international agency called SHADO defends Earth from alien invaders.
This is a Robbery: The World’s Biggest Art Heist
In 1990, two men dressed as cops con their way into a Boston museum and steal a fortune in art. Take a deep dive into this daring and notorious crime.
Stranded with a Million Dollars
The series drops 10 adventurers on an island with nothing but the clothes on their backs and a million dollars in cash. Those who survive for 40 days filled with…
Billion Dollar Wreck
MartinBayerle,whofirstlocatedthesunkenRMSRepublicin270feetofwatersouthoftheislandNantucketin1981,makeshissecondmajorrecoverymissiontothewreck.Thevessel,builtin1903andsunkwhenshewasinadvertentlyrimmedbroadsideinpoorvisibilityin1909,isrumoredtohaveonboarduntoldmillionsinface-valuegoldcoins-anamountthatcouldexceed$1Billionintoday’scurrencyvalues.Bayerle,whowasonceimprisonedformanslaughteraftershootingandkillingamanwhowashavinganaffairwithhiswifeandattemptedtoextortmoneyfromBayerletoleave,maypossessbetterinformationastowhereonthewreckagethegoldmayrest;he’sassembledagroupofprovensalvers,includinghisownson,todive,explore,andifpossiblerecovertheentombedriches.Writtenbyjb0579
Baking Impossible
Top bakers and engineers team up to build edible creations that must taste delicious and survive intense engineering stress tests to win $100,000.
Mickey and the Roadster Racers
Mickey Mouse and his pals Minnie, Pluto, Goofy, Daisy and Donald take their unique transforming vehicles on humorous high-spirited races around the globe as well as hometown capers in Hot…
RuPaul’s Drag Race All Stars
The most celebrated competitors from RuPaul’s Drag Race vie for a second chance to enter Drag Race herstory. This drag queen showdown is filled with plenty of heated competition, lip-syncing…
Constantine: City of Demons
This all-new animated series from Warner Bros. Animation and Blue Ribbon Content follows DC’s popular comic book character John Constantine (voiced by the live action series star Matt Ryan), a…