MadeByDestructionistheultimatemakeovershowwhereeverydayobjectsarerescuedfromthetrashandrecreatedintosomethingentirelynew.Fromdiscardedskateboards,abandonedcars,andoldofficeequipmentthataresalvagedandshredded,melted,andchopped-thenrepurposedintothingsthatareuseful,beautiful,andvaluable.

The protagonist Qin Chen, who was originally the top genius in the military domain, was conspired by the people to fall into the death canyon in the forbidden land of…

The fantastical misadventures of Ernesto, Tanya, and Kevin—three twenty-something best friends navigating early adulthood in a world where the strange and surreal are an everyday thing.

Ride along with Hot Rod’s David Freiburger and Mike Finnegan as they continue their love/hate relationship with hot rods, street machines and other highly strung performance vehicles. In Roadkill, Freiburger…

Stuntman Cha Dal-geon gets involved in a tragic airplane crash and ends up discovering a national corruption scandal in the process. Go Hae-ri, the oldest daughter of a deceased marine,…

Some of the most skilled brick fanatics do battle to be crowned Lego Master

EmptyNestissetinMiamiandtellsofthedaytodaymisadventuresofawidowedpediatrician,HarryWeston,andhistwoadultdaughters,BarbaraandCarolWeston,whohavecomebacktolivewithhimafterfailedmarriages.MuchofthehumourisderivedfromBarbaraandCarols’ongoingattempts,andfailure,tofindtheperfectpartner,andonceagainleavethenest.Thereisalsotheskirt-chasingnextdoorneighbour,CharlieDietzandHarry’ssouthernnurse,LaverneTodd,uniqueforherunbelievableHickorystories.WrittenbyCampbelccampbelc@ozemail.com.au

A team of esteemed experts re-investigate the cases of three inmates who have been locked up for decades and claim they’re innocent.

Fauna Hodel, who was given away by her teenage birth mother, begins to investigate the secrets to her past, following a sinister trail that swirls ever closer to an infamous…

This 1970s period dramedy inspired by the real life Kyle Richards and set amid the sexual revolution and the rise of second-wave feminism follows Bonnie, an unconventional mother struggling to…

TheCOVID-19virus,oftenreferredtoastheCorona-virus,isbelievedtohaveoriginatedfromaso-calledwetmarketinWuhan,wherewildanimalshavebeenshovedintocrowdedcagesalongsideeachother,readytobekilledandcookedinfrontofcustomers.Insuchplaces,youcaneasilybeexposedtoinfectiousdiseases.Thisvideoalsoprovidesusacloserlookatthefascinatingmammal,thepangolin,thatisunfortunatelythemosttraffickedanimalspeciesintheworld.Writtenbychribren

Diveintoaworldwhereasinglelifecanlastathousandyears,withDavidAttenborough.Seethingsnoeyehaseverseen,anddiscoverthedramatic,beautifulplantlifeofEarth.