Children lip sync pop songs in celebration of their favorite artists.

This anthology series is a post-modernist reinvention of older movies that turns pre-existing imagery from the public domain on its head to tell brand new unique stories spanning genres including…

Dateline: November 1967. Within klicks of Danang, Vietnam, sits a U.S. Army base, bar and hospital on China Beach filled with wounded soldiers and one very lovely but damaged Army…

Ashley was nipping at the heels of a middle class life in Oakland until Miles, her partner of 12 years and father of their son, is suddenly incarcerated, leaving her…

A pro League of Legends esports team pursues their first championship after years of close calls and heartache. To win it all, they will need their prodigy, a 17-year-old rookie,…

Fivefraternitybrothersintheir30sbondwitheachotherandtheirwomeninthisdramaticseriescreated,executiveproducedandwrittenbyNewYorkTimesBestsellingAuthorZane,whowasalsobehindZane’sSexChronicles.

Not Available

TheCOVID-19virus,oftenreferredtoastheCorona-virus,isbelievedtohaveoriginatedfromaso-calledwetmarketinWuhan,wherewildanimalshavebeenshovedintocrowdedcagesalongsideeachother,readytobekilledandcookedinfrontofcustomers.Insuchplaces,youcaneasilybeexposedtoinfectiousdiseases.Thisvideoalsoprovidesusacloserlookatthefascinatingmammal,thepangolin,thatisunfortunatelythemosttraffickedanimalspeciesintheworld.Writtenbychribren

The chaotic and violent struggle to control wealth and power in the North American fur trade in late 18th century Canada. Told from multiple perspectives, Frontier takes place in a…

The Sentinel is a Canadian-produced television series. In the jungles of peru, the fight for survival heightened his senses. Now, Detective Jim Ellison is a sentinel in the fight for…

Svensson, Svensson is a Swedish sitcom. It has also been made into a feature film and a play. Two seasons consisting of 12 episodes each were broadcast in the autumn…

In a backwater corner of the South Pacific in 1938, a young American adventurer and his ragtag group of friends become involved in death-defying hi-jinx, transporting people-on-the-run in a well-worn…