HMS Queen Elizabeth is the largest and most advanced warship ever constructed in Britain. As she embarks on gruelling sea trials we see ship and crew pushed to breaking point.

A series of brand new, hand-crafted, half hours of theatrical catastrophe as The Cornley Polytechnic Drama Society undertake more (overly) ambitious endeavours.

David Reynolds traces the legacy of the Great War across 100 years and 10 different countries, examining how the war haunted a generation and shaped the peace that followed.

By day the workplace is rational and efficient, but at night the same offices, hotels and restaurants become the domain of the supernatural and unexplained. Those who work the graveyard…

One of the top athletic high schools with a storied basketball program and the highest graduation rate in New Jersey, the series will follow the brotherhood of young men who…

Set against the backdrop of the city of Amsterdam, Piet Van der Valk and his team investigate a series of high-profile cases immersed in the worlds of art, politics, addiction,…

The Angry Video Game Nerd is an adult web television series of comedic retrogaming video reviews created by and starring James Rolfe. The show’s format revolves around his commentary and…

BeforeSaulGoodman,beforeJimmyMcGill,therewas:Slippin’Jim.He’saslyyoungslickstertryingtomakeitthroughCatholicschoolwithoutlandinghimselfandhisbestpalMarcindetention-again!

In 1994, a toddler disappeared from a small Welsh village, never to be seen again. 23 years later, in London, the mother of rising cello star Matilda Gray commits suicide,…

MartinBayerle,whofirstlocatedthesunkenRMSRepublicin270feetofwatersouthoftheislandNantucketin1981,makeshissecondmajorrecoverymissiontothewreck.Thevessel,builtin1903andsunkwhenshewasinadvertentlyrimmedbroadsideinpoorvisibilityin1909,isrumoredtohaveonboarduntoldmillionsinface-valuegoldcoins-anamountthatcouldexceed$1Billionintoday’scurrencyvalues.Bayerle,whowasonceimprisonedformanslaughteraftershootingandkillingamanwhowashavinganaffairwithhiswifeandattemptedtoextortmoneyfromBayerletoleave,maypossessbetterinformationastowhereonthewreckagethegoldmayrest;he’sassembledagroupofprovensalvers,includinghisownson,todive,explore,andifpossiblerecovertheentombedriches.Writtenbyjb0579

Masumiyet follows the story of Bahar, a married mother of two, whose life changes drastically after her 19-year-old daughter falls in love with a wrong man. Her daughter Ela’s first…

A musical talent show, in which contestants showcase their talent and the viewers are the judges, voting through an application during song performances.