Farang Season 1 Episode 6
N/A
Views: 15
Serie: Farang
Director: Daniel di Grado
Guest Star: Anna Bjelkerud, Errah Seno, Gerhard Hoberstorfer, Jacques Karlberg, Louise Nyvall, Maethi Thapthimthong, Ola Rapace, Sahajak Boonthanakit, Sahatchai 'Stop' Chumrum, Yayaying Rhatha Phongam, Yothin Udomsanti
Residue
Thegovernmentcover-upofthecausesbehindamassiveexplosioninafuturisticUKmetropolisspurphotojournalistJenniferPrestonontosearchforthetruthandintheprocessblowopenaparanormalphenomenonhauntingthecity.
Mysteries & Scandals
A true crime series investigating Hollywood’s most intriguing criminals, murders and cases of corruption, exploring infamous headlines that captured the nation’s attention using archival footage, new interviews and stylized depictions…
Narco Wars
Narco Wars explores how opportunistic smuggling networks in Latin America turned into powerful and ruthless drug cartels with the power to destabilize and tear apart whole countries. The series combines…
Restaurant Redemption
Ching-HeHuangtravelsthecountrytohelpownersofstrugglingAsianrestaurantsrevitalizetheirmenusbygivingthemnewinspirationanddirectiontoturntheirbusinessesaround.
The Eleven
Reverie
A former detective specializing in human behavior is brought in when the launch of an advanced virtual reality program has dangerous and unintended consequences.
Christmas Cookie Challenge
The Origins of Coronavirus Explained in 1 Minute
TheCOVID-19virus,oftenreferredtoastheCorona-virus,isbelievedtohaveoriginatedfromaso-calledwetmarketinWuhan,wherewildanimalshavebeenshovedintocrowdedcagesalongsideeachother,readytobekilledandcookedinfrontofcustomers.Insuchplaces,youcaneasilybeexposedtoinfectiousdiseases.Thisvideoalsoprovidesusacloserlookatthefascinatingmammal,thepangolin,thatisunfortunatelythemosttraffickedanimalspeciesintheworld.Writtenbychribren
The Last Word with Lawrence O’Donnell
The Last Word with Lawrence O’Donnell is an hour-long weeknight news and political commentary program on MSNBC. The program airs live at 10:00 P.M. Eastern Time Monday-Friday, and is hosted…
Dark/Web
A horror anthology series that explores the dangers of a totally connected world.
Bethenny Getting Married?
Betweenmotherhood,marriageandbuildingher’SkinnyGirl’empire,Bethennyfindsherlifeisinthefastlane-andmovingatwarpspeed.Watchasshecontinuestogrowherbusinessandventureoutintonewareas,allwhilejugglingmotherhoodandmarriage.Whenthingsgetstressful,Bethennymanagestohandleitallwithherentertainingwitandbitinghumor.